PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.06G106700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 331aa    MW: 36866.3 Da    PI: 4.7005
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.06G106700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.8e-092733072155
                          HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
             Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                          k +yp+++++  LA+ +gL+++q+ +WF N+R ++
  Manes.06G106700.1.p 273 KWPYPTEADKVALADATGLDQKQINNWFINQRKRH 307
                          579*****************************885 PP

2ELK39.51.2e-13227248122
                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                          ELK+ LlrKYsgy+++LkqEFs
  Manes.06G106700.1.p 227 ELKDKLLRKYSGYISTLKQEFS 248
                          9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.7E-2287131IPR005540KNOX1
PfamPF037902.5E-2388129IPR005540KNOX1
SMARTSM012563.2E-26138189IPR005541KNOX2
PfamPF037915.8E-25142188IPR005541KNOX2
SMARTSM011887.1E-8227248IPR005539ELK domain
PROSITE profilePS5121311.086227247IPR005539ELK domain
PfamPF037894.6E-11227248IPR005539ELK domain
PROSITE profilePS5007112.503247310IPR001356Homeobox domain
SuperFamilySSF466891.24E-19248320IPR009057Homeodomain-like
SMARTSM003891.3E-13249314IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-27252311IPR009057Homeodomain-like
CDDcd000862.44E-13259311No hitNo description
PfamPF059206.5E-17267306IPR008422Homeobox KN domain
PROSITE patternPS000270285308IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MDELYPFNSS PSDYPMQVVL PENIIPPPPD YHVFQSPGSS SFPAVGSDHL FSGSSVSDTA  60
SMVAEMQRGG GAGGGSSGVG SEEEVSSTIR AKIASHPLYP KLLQAYIDCQ KVGAPPEMVY  120
LLDEIRQESN LPNRSTVVPS CLGADPELDE FMETYCDILV KYKSDLSRPF NEATTFLNDV  180
EAQLNTLCNN SSRLTHVSDE AVGSSDEDAS GGEVEMQDCV RANEDRELKD KLLRKYSGYI  240
STLKQEFSKK KKKGKLPKEA RQILLNWWNI HYKWPYPTEA DKVALADATG LDQKQINNWF  300
INQRKRHWKP SENMQFAVVE SIYGPFFMND *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002511373.10.0PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS61e-120KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLB9RAZ80.0B9RAZ8_RICCO; Homeobox protein knotted-1, putative
STRINGVIT_17s0000g08710.t011e-155(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62034125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-114KNOTTED1-like homeobox gene 6